SHOX2 Antibody (1D1)

• Supplier: Novus Biologicals
• Catalog: H00006474-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 1D1
• Applications: WB ELISA Gene Silencing
• Species Reactivities: Human, Rat
• Antigen: SHOX2 (NP_006875 117 a.a. - 204 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: SHOX2
• Conjugate: Unconjugated

Product images

Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - SHOX2 monoclonal antibody (M01), clone 1D1 Analysis of SHOX2 expression in PC-12.

Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - Analysis of SHOX2 over-expressed 293 cell line, cotransfected with SHOX2 Validated Chimera RNAi ( Cat # H00006474-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SHOX2 monoclonal antibody (M01), clone 1D1 (Cat # H00006474-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - Analysis of SHOX2 expression in transfected 293T cell line by SHOX2 monoclonal antibody (M01), clone 1D1.Lane 1: SHOX2 transfected lysate(37.6 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: SHOX2 Antibody (1D1) [H00006474-M01] - Detection limit for recombinant GST tagged SHOX2 is 1 ng/ml as a capture antibody.