TNP1 Antibody (1B5)
| Name | TNP1 Antibody (1B5) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007141-M01 |
| Prices | $10.00, $359.00 |
| Sizes | 100 µg, 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 1B5 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | TNP1 (AAH29516.1, 1 a.a. - 55 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | TNP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TNP1 Antibody (1B5) [H00007141-M01] - Analysis of monoclonal antibody to TNP1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10381_TNP1-Antibody-(1B5)-Immunohistochemistry-Paraffin-H00007141-M01-img0004.jpg)
Immunohistochemistry-Paraffin: TNP1 Antibody (1B5) [H00007141-M01] - Analysis of monoclonal antibody to TNP1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
![Sandwich ELISA: TNP1 Antibody (1B5) [H00007141-M01] - Detection limit for recombinant GST tagged TNP1 is approximately 0.03ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10382_TNP1%2520Antibody%2520(1B5)-Sandwich%2520ELISA-H00007141-M01-img0005.jpg)
Sandwich ELISA: TNP1 Antibody (1B5) [H00007141-M01] - Detection limit for recombinant GST tagged TNP1 is approximately 0.03ng/ml as a capture antibody.