Name | DBPA Antibody (1H5) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00008531-M06 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1H5 |
Applications | WB ELISA ICC/IF |
Species Reactivities | Human |
Antigen | CSDA (NP_003642 241 a.a. - 330 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | YBX3 |
Conjugate | Unconjugated |
Supplier Page | Shop |