CDX4 Antibody (1E9.)

• Supplier: Novus Biologicals
• Catalog: H00001046-M12
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 1E9.
• Applications: WB ELISA ICC/IF
• Species Reactivities: Human, Rat
• Antigen: CDX4 (NP_005184 202 a.a. - 284 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: CDX4
• Conjugate: Unconjugated

Product images

Western Blot: CDX4 Antibody (1E9) [H00001046-M12] - Analysis of CDX4 expression in PC-12 (Cat # L012V1).

Immunocytochemistry/Immunofluorescence: CDX4 Antibody (1E9) [H00001046-M12] - Analysis of monoclonal antibody to CDX4 on HeLa cell. Antibody concentration 10 ug/ml

Western Blot: CDX4 Antibody (1E9) [H00001046-M12] - Analysis of CDX4 expression in HeLa (Cat # L013V1).

Western Blot: CDX4 Antibody (1E9) [H00001046-M12] - Analysis of CDX4 expression in Raw 264.7 (Cat # L024V1).