Rho GTPase activating protein 39 Antibody

Name Rho GTPase activating protein 39 Antibody
Supplier Novus Biologicals
Catalog NBP1-90619
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:PEPDTEKAQELPARAGRPAAFGTVKEDSGSSSPPGVFLEKDYEIYRDYSADGQLLHYRTSSLRWNSGAKERMLIKVADRE
Purity/Format Immunogen affinity purified
Blocking Peptide Rho GTPase activating protein 39 Protein
Description Rabbit Polyclonal
Gene ARHGAP39
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.