GRAF Antibody
| Name | GRAF Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89732 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GRAF Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ARHGAP26 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GRAF Antibody [NBP1-89732] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24385_GRAF%2520Antibody-Western%2520Blot-NBP1-89732-img0006.jpg)
![Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24386_GRAF-Antibody-Immunohistochemistry-Paraffin-NBP1-89732-img0007.jpg)