Polypeptide GalNac Transferase 7/GALNT7 Antibody
| Name | Polypeptide GalNac Transferase 7/GALNT7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39021 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Polypeptide GalNac Transferase 7/GALNT7 Protein |
| Description | Rabbit Polyclonal |
| Gene | GALNT7 |
| Supplier Page | Shop |
Product images
![Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17715_Polypeptide%2520GalNac%2520Transferase%25207-GALNT7%2520Antibody-Western%2520Blot-NBP2-39021-img0002.jpg)
Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: RT-4
![Immunohistochemistry: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human uterus shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17716_Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunohistochemistry-NBP2-39021-img0001.jpg)
Immunohistochemistry: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human uterus shows strong granular cytoplasmic positivity in glandular cells.