SYT11 Antibody
| Name | SYT11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39015 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SYT11 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYT11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SYT11 Antibody [NBP2-39015] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10703_SYT11%2520Antibody-Western%2520Blot-NBP2-39015-img0002.jpg)
![Immunohistochemistry: SYT11 Antibody [NBP2-39015] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10704_SYT11-Antibody-Immunohistochemistry-NBP2-39015-img0001.jpg)