C19orf45 Antibody

Name C19orf45 Antibody
Supplier Novus Biologicals
Catalog NBP2-39071
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: LTMKQKMLKPHRTPPAPVTEEMLQRCKYSHMEPPLGGLRFFSTQYKDEFPFKYQGPAALRLKNPQEGFVPLGTPHQRGCREKIDPLV
Purity/Format Immunogen affinity purified
Blocking Peptide C19orf45 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene C19orf45
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.