CLN6 Antibody
| Name | CLN6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39066 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: WNDPVLRKKYPGVIYVPEPWAFYTLHVSSR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CLN6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CLN6 |
| Supplier Page | Shop |
![Western Blot: CLN6 Antibody [NBP2-39066] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: RT-4<br/>Lane 3: U-251 MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17783_CLN6%2520Antibody-Western%2520Blot-NBP2-39066-img0002.jpg)
![Immunohistochemistry: CLN6 Antibody [NBP2-39066] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17784_CLN6-Antibody-Immunohistochemistry-NBP2-39066-img0001.jpg)