SFRS14 Antibody
| Name | SFRS14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38906 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ESRDYDVDHPGEADSVLRGGSQVQARGRALNIVDQEGSLLGKGETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDVTLG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SFRS14 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SUGP2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SFRS14 Antibody [NBP2-38906] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17787_SFRS14-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38906-img0001.jpg)
Immunocytochemistry/Immunofluorescence: SFRS14 Antibody [NBP2-38906] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
![Immunohistochemistry: SFRS14 Antibody [NBP2-38906] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17788_SFRS14%2520Antibody-Immunohistochemistry-NBP2-38906-img0002.jpg)
Immunohistochemistry: SFRS14 Antibody [NBP2-38906] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.