PRR14L Antibody
| Name | PRR14L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38968 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ASTVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSLRETQEMTEGSRLEPNSEFGKEST |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PRR14L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PRR14L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PRR14L Antibody [NBP2-38968] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11169_PRR14L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38968-img0003.jpg)
Immunocytochemistry/Immunofluorescence: PRR14L Antibody [NBP2-38968] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
![Immunohistochemistry: PRR14L Antibody [NBP2-38968] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal calls.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11170_PRR14L-Antibody-Immunohistochemistry-NBP2-38968-img0002.jpg)
Immunohistochemistry: PRR14L Antibody [NBP2-38968] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal calls.