FAM83A Antibody
| Name | FAM83A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38965 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GVFVCVLLDQGGVKLFQEMCDKVQISDSHLKNISIRSVEGEIYCAKSGRKFAGQIREKFIISDWRFVLSGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM83A Protein |
| Description | Rabbit Polyclonal |
| Gene | FAM83A |
| Supplier Page | Shop |
Product images
![Western Blot: FAM83A Antibody [NBP2-38965] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: RT-4<br/>Lane 3: U-251 MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: Tonsil](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17841_FAM83A%2520Antibody-Western%2520Blot-NBP2-38965-img0002.jpg)
Western Blot: FAM83A Antibody [NBP2-38965] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
![Immunohistochemistry: FAM83A Antibody [NBP2-38965] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17842_FAM83A-Antibody-Immunohistochemistry-NBP2-38965-img0001.jpg)
Immunohistochemistry: FAM83A Antibody [NBP2-38965] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.