VWA5B2 Antibody
| Name | VWA5B2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38918 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | VWA5B2 Protein |
| Description | Rabbit Polyclonal |
| Gene | VWA5B2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: VWA5B2 Antibody [NBP2-38918] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/571_VWA5B2-Antibody-Immunohistochemistry-Paraffin-NBP2-38918-img0002.jpg)
Immunohistochemistry-Paraffin: VWA5B2 Antibody [NBP2-38918] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.