Dystrobrevin beta Antibody
| Name | Dystrobrevin beta Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38915 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Dystrobrevin beta Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DTNB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Dystrobrevin beta Antibody [NBP2-38915] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10311_Dystrobrevin%2520beta%2520Antibody-Western%2520Blot-NBP2-38915-img0002.jpg)
Western Blot: Dystrobrevin beta Antibody [NBP2-38915] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
![Immunohistochemistry: Dystrobrevin beta Antibody [NBP2-38915] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10312_Dystrobrevin-beta-Antibody-Immunohistochemistry-NBP2-38915-img0001.jpg)
Immunohistochemistry: Dystrobrevin beta Antibody [NBP2-38915] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.