PKN3 Antibody
| Name | PKN3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38849 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PKN3 Protein |
| Description | Rabbit Polyclonal |
| Gene | PKN3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PKN3 Antibody [NBP2-38849] - Staining of human kidney shows moderate cytoplasmic positivity renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/264_PKN3%2520Antibody-Immunohistochemistry-Paraffin-NBP2-38849-img0003.jpg)
Immunohistochemistry-Paraffin: PKN3 Antibody [NBP2-38849] - Staining of human kidney shows moderate cytoplasmic positivity renal tubules.