SH3RF2 Antibody
| Name | SH3RF2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38841 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SH3RF2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SH3RF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SH3RF2 Antibody [NBP2-38841] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5696_SH3RF2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38841-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SH3RF2 Antibody [NBP2-38841] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
![Immunohistochemistry: SH3RF2 Antibody [NBP2-38841] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5697_SH3RF2-Antibody-Immunohistochemistry-NBP2-38841-img0002.jpg)
Immunohistochemistry: SH3RF2 Antibody [NBP2-38841] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.