NHE6/SLC9A6 Antibody
| Name | NHE6/SLC9A6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38877 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NHE6/SLC9A6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC9A6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NHE6/SLC9A6 Antibody [NBP2-38877] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8325_NHE6-SLC9A6%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38877-img0003.jpg)
Immunocytochemistry/Immunofluorescence: NHE6/SLC9A6 Antibody [NBP2-38877] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
![Immunohistochemistry: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8326_NHE6-SLC9A6-Antibody-Immunohistochemistry-NBP2-38877-img0002.jpg)
Immunohistochemistry: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.