RCOR1/CoREST Antibody
| Name | RCOR1/CoREST Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38720 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RCOR1/CoREST Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RCOR1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RCOR1/CoREST Antibody [NBP2-38720] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17949_RCOR1-CoREST-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38720-img0001.jpg)
Immunocytochemistry/Immunofluorescence: RCOR1/CoREST Antibody [NBP2-38720] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
![Immunohistochemistry: RCOR1/CoREST Antibody [NBP2-38720] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17950_RCOR1-CoREST%2520Antibody-Immunohistochemistry-NBP2-38720-img0002.jpg)
Immunohistochemistry: RCOR1/CoREST Antibody [NBP2-38720] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.