FBXL16 Antibody
| Name | FBXL16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38789 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: CPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FBXL16 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FBXL16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FBXL16 Antibody [NBP2-38789] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6275_FBXL16%2520Antibody-Western%2520Blot-NBP2-38789-img0002.jpg)
![Immunohistochemistry: FBXL16 Antibody [NBP2-38789] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6276_FBXL16-Antibody-Immunohistochemistry-NBP2-38789-img0001.jpg)