DYRK4 Antibody
| Name | DYRK4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38781 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DYRK4 Protein |
| Description | Rabbit Polyclonal |
| Gene | DYRK4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DYRK4 Antibody [NBP2-38781] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6311_DYRK4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38781-img0003.jpg)
Immunocytochemistry/Immunofluorescence: DYRK4 Antibody [NBP2-38781] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
![Immunohistochemistry: DYRK4 Antibody [NBP2-38781] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6312_DYRK4-Antibody-Immunohistochemistry-NBP2-38781-img0002.jpg)
Immunohistochemistry: DYRK4 Antibody [NBP2-38781] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.