WDR36 Antibody
| Name | WDR36 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38364 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: APLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | WDR36 Protein |
| Description | Rabbit Polyclonal |
| Gene | WDR36 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: WDR36 Antibody [NBP2-38364] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26866_WDR36%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38364-img0003.jpg)
![Immunohistochemistry: WDR36 Antibody [NBP2-38364] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26867_WDR36-Antibody-Immunohistochemistry-NBP2-38364-img0002.jpg)