MMADHC Antibody
| Name | MMADHC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38351 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TLPDVLAEPLSSERHEFVMAQYVNEFQGNDAPVEQEINSAETYFESARVECAIQTCPELLRKDFESLFPEVANGKLMILTVTQKTKNDMTVWSEEV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MMADHC Protein |
| Description | Rabbit Polyclonal |
| Gene | MMADHC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MMADHC Antibody [NBP2-38351] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26842_MMADHC-Antibody-Western-Blot-NBP2-38351-img0002.jpg)
Western Blot: MMADHC Antibody [NBP2-38351] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate
![Immunohistochemistry-Paraffin: MMADHC Antibody [NBP2-38351] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26843_MMADHC-Antibody-Immunohistochemistry-Paraffin-NBP2-38351-img0003.jpg)
Immunohistochemistry-Paraffin: MMADHC Antibody [NBP2-38351] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.