Kanadaptin Antibody
| Name | Kanadaptin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38315 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Kanadaptin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC4A1AP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Kanadaptin Antibody [NBP2-38315] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8933_Kanadaptin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38315-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Kanadaptin Antibody [NBP2-38315] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
![Immunohistochemistry: Kanadaptin Antibody [NBP2-38315] - Staining of human testis shows strong nuclear and cytoplasmic positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8934_Kanadaptin-Antibody-Immunohistochemistry-NBP2-38315-img0002.jpg)
Immunohistochemistry: Kanadaptin Antibody [NBP2-38315] - Staining of human testis shows strong nuclear and cytoplasmic positivity.