Calpastatin Antibody
| Name | Calpastatin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38335 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: STYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Calpastatin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CAST |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Calpastatin Antibody [NBP2-38335] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10347_Calpastatin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38335-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Calpastatin Antibody [NBP2-38335] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & endoplasmic reticulum.
![Immunohistochemistry: Calpastatin Antibody [NBP2-38335] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10348_Calpastatin-Antibody-Immunohistochemistry-NBP2-38335-img0002.jpg)
Immunohistochemistry: Calpastatin Antibody [NBP2-38335] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.