shootin-1 Antibody

Name shootin-1 Antibody
Supplier Novus Biologicals
Catalog NBP2-38374
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: NRVSMLAVEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEERIQHQQK
Purity/Format Immunogen affinity purified
Blocking Peptide shootin-1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene KIAA1598
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.