GRB 14 Antibody
| Name | GRB 14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38230 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GRB 14 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GRB14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: GRB 14 Antibody [NBP2-38230] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts, Leydig cells were strongly stained.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19729_GRB-14-Antibody-Immunohistochemistry-Paraffin-NBP2-38230-img0003.jpg)
Immunohistochemistry-Paraffin: GRB 14 Antibody [NBP2-38230] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts, Leydig cells were strongly stained.