CCDC115 Antibody
| Name | CCDC115 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38210 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLHASEAQEGLQKFKVVR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC115 Protein |
| Description | Rabbit Polyclonal |
| Gene | CCDC115 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CCDC115 Antibody [NBP2-38210] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus and vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18109_CCDC115-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38210-img0001.jpg)
Immunocytochemistry/Immunofluorescence: CCDC115 Antibody [NBP2-38210] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus and vesicles.
![Immunohistochemistry: CCDC115 Antibody [NBP2-38210] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18110_CCDC115%2520Antibody-Immunohistochemistry-NBP2-38210-img0002.jpg)
Immunohistochemistry: CCDC115 Antibody [NBP2-38210] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.