HELT Antibody
| Name | HELT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38288 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HELT Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HELT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HELT Antibody [NBP2-38288] - Analysis in control (vector only transfected HEK293T lysate) and HELT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7760_HELT%2520Antibody-Western%2520Blot-NBP2-38288-img0003.jpg)
Western Blot: HELT Antibody [NBP2-38288] - Analysis in control (vector only transfected HEK293T lysate) and HELT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunohistochemistry: HELT Antibody [NBP2-38288] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7761_HELT-Antibody-Immunohistochemistry-NBP2-38288-img0001.jpg)
Immunohistochemistry: HELT Antibody [NBP2-38288] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.