Phosphoribosyl Pyrophosphate Amidotransferase Antibody
| Name | Phosphoribosyl Pyrophosphate Amidotransferase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38279 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Phosphoribosyl Pyrophosphate Amidotransferase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPAT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP2-38279] - Staining of human cell line U-2 OS shows localization to midbody ring.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6628_Phosphoribosyl-Pyrophosphate-Amidotransferase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38279-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP2-38279] - Staining of human cell line U-2 OS shows localization to midbody ring.
![Immunohistochemistry: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP2-38279] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6629_Phosphoribosyl-Pyrophosphate-Amidotransferase-Antibody-Immunohistochemistry-NBP2-38279-img0002.jpg)
Immunohistochemistry: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP2-38279] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.