PIK3R4 Antibody
| Name | PIK3R4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38276 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PIK3R4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PIK3R4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PIK3R4 Antibody [NBP2-38276] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6632_PIK3R4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38276-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PIK3R4 Antibody [NBP2-38276] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
![Immunohistochemistry-Paraffin: PIK3R4 Antibody [NBP2-38276] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6633_PIK3R4-Antibody-Immunohistochemistry-Paraffin-NBP2-38276-img0003.jpg)
Immunohistochemistry-Paraffin: PIK3R4 Antibody [NBP2-38276] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.