MAPKBP1 Antibody
| Name | MAPKBP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38164 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PSSPQRASGPNRHQAPSMLSPGPALSSDSDKEGEDEGTEEELPALPVLAKSTKKALASVPSPALPRSLSHWEMSRAQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MAPKBP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MAPKBP1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MAPKBP1 Antibody [NBP2-38164] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18181_MAPKBP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38164-img0001.jpg)
Immunocytochemistry/Immunofluorescence: MAPKBP1 Antibody [NBP2-38164] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.
![Immunohistochemistry: MAPKBP1 Antibody [NBP2-38164] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18182_MAPKBP1%2520Antibody-Immunohistochemistry-NBP2-38164-img0002.jpg)
Immunohistochemistry: MAPKBP1 Antibody [NBP2-38164] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts.