PMP70 Antibody
| Name | PMP70 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38199 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PMP70 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ABCD3 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PMP70 Antibody [NBP2-38199] - Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18199_PMP70-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38199-img0001.jpg)
![Immunohistochemistry: PMP70 Antibody [NBP2-38199] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18200_PMP70%2520Antibody-Immunohistochemistry-NBP2-38199-img0002.jpg)