ZC2HC1B Antibody
| Name | ZC2HC1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38137 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KTPQSKSPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZC2HC1B Protein |
| Description | Rabbit Polyclonal |
| Gene | ZC2HC1B |
| Supplier Page | Shop |
Product images
![Western Blot: ZC2HC1B Antibody [NBP2-38137] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative Control<br/>Lane 3: LY425352](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18231_ZC2HC1B%2520Antibody-Western%2520Blot-NBP2-38137-img0002.jpg)
Western Blot: ZC2HC1B Antibody [NBP2-38137] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative Control
Lane 3: LY425352
![Immunohistochemistry: ZC2HC1B Antibody [NBP2-38137] - Staining of human vagina shows distinct cytoplasmic and membranous positivity in lower layers of squamous epithelium.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18232_ZC2HC1B-Antibody-Immunohistochemistry-NBP2-38137-img0001.jpg)
Immunohistochemistry: ZC2HC1B Antibody [NBP2-38137] - Staining of human vagina shows distinct cytoplasmic and membranous positivity in lower layers of squamous epithelium.