Enah/Vasp-like Antibody
| Name | Enah/Vasp-like Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38132 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SNSVEKPVSSILSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Enah/Vasp-like Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EVL |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Enah/Vasp-like Antibody [NBP2-38132] - Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18239_Enah-Vasp-like-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38132-img0001.jpg)
Immunocytochemistry/Immunofluorescence: Enah/Vasp-like Antibody [NBP2-38132] - Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
![Immunohistochemistry: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human tonsil shows strong cytoplasmic positivity in germinal and non germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18240_Enah-Vasp-like%2520Antibody-Immunohistochemistry-NBP2-38132-img0002.jpg)
Immunohistochemistry: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human tonsil shows strong cytoplasmic positivity in germinal and non germinal center cells.