TJP3 Antibody
| Name | TJP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38696 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TJP3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TJP3 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TJP3 Antibody [NBP2-38696] - Immunofluorescent staining of human cell line CACO-2 shows positivity in cell junctions and nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18315_TJP3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38696-img0001.jpg)
Immunocytochemistry/Immunofluorescence: TJP3 Antibody [NBP2-38696] - Immunofluorescent staining of human cell line CACO-2 shows positivity in cell junctions and nucleus but excluded from the nucleoli.
![Immunohistochemistry: TJP3 Antibody [NBP2-38696] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18316_TJP3%2520Antibody-Immunohistochemistry-NBP2-38696-img0002.jpg)
Immunohistochemistry: TJP3 Antibody [NBP2-38696] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.