RHAMM/CD168 Antibody
| Name | RHAMM/CD168 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38516 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVKSSESKKESQKNDKDLKILEKEIRVLLQERGAQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RHAMM/CD168 Protein |
| Description | Rabbit Polyclonal |
| Gene | HMMR |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CD168 Antibody [NBP2-38516] - Immunofluorescent staining of human cell line U-2 OS shows positivity in microtubules and centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18379_CD168-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38516-img0001.jpg)
Immunocytochemistry/Immunofluorescence: CD168 Antibody [NBP2-38516] - Immunofluorescent staining of human cell line U-2 OS shows positivity in microtubules and centrosome.
![Immunohistochemistry: CD168 Antibody [NBP2-38516] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18380_CD168%2520Antibody-Immunohistochemistry-NBP2-38516-img0002.jpg)
Immunohistochemistry: CD168 Antibody [NBP2-38516] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.