R3HDM2 Antibody
| Name | R3HDM2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38405 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEIEKECEDTSLRQETQRRTSNHGHARKRAKSNSKLKL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | R3HDM2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | R3HDM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: R3HDM2 Antibody [NBP2-38405] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4391_R3HDM2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38405-img0003.jpg)
Immunocytochemistry/Immunofluorescence: R3HDM2 Antibody [NBP2-38405] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry: R3HDM2 Antibody [NBP2-38405] - Staining of human colon shows strong cytoplasmic and nucleolar/ or nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4392_R3HDM2-Antibody-Immunohistochemistry-NBP2-38405-img0002.jpg)
Immunohistochemistry: R3HDM2 Antibody [NBP2-38405] - Staining of human colon shows strong cytoplasmic and nucleolar/ or nuclear positivity in glandular cells.