PLEKHM1 Antibody

Name PLEKHM1 Antibody
Supplier Novus Biologicals
Catalog NBP2-38449
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: PARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGR
Purity/Format Immunogen affinity purified
Blocking Peptide PLEKHM1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PLEKHM1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.