DNAJC5G Antibody
| Name | DNAJC5G Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38484 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DNAJC5G Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DNAJC5G |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DNAJC5G Antibody [NBP2-38484] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11971_DNAJC5G%2520Antibody-Western%2520Blot-NBP2-38484-img0002.jpg)
Western Blot: DNAJC5G Antibody [NBP2-38484] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate
![Immunohistochemistry: DNAJC5G Antibody [NBP2-38484] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11972_DNAJC5G-Antibody-Immunohistochemistry-NBP2-38484-img0001.jpg)
Immunohistochemistry: DNAJC5G Antibody [NBP2-38484] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.