dynein, cytoplasmic 2, light intermediate chain 1 Antibody
| Name | dynein, cytoplasmic 2, light intermediate chain 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38008 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | dynein, cytoplasmic 2, light intermediate chain 1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DYNC2LI1 |
| Supplier Page | Shop |
Product images
![Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: RT-4<br/>Lane 3: U-251 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18503_dynein-%2520cytoplasmic%25202-%2520light%2520intermediate%2520chain%25201%2520Antibody-Western%2520Blot-NBP2-38008-img0002.jpg)
Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: RT-4
Lane 3: U-251 MG
![Immunohistochemistry: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Staining of human fallopian tube shows strong positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18504_dynein--cytoplasmic-2--light-intermediate-chain-1-Antibody-Immunohistochemistry-NBP2-38008-img0001.jpg)
Immunohistochemistry: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Staining of human fallopian tube shows strong positivity in glandular cells.