DDX11 Antibody
| Name | DDX11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38060 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DDX11 Protein |
| Description | Rabbit Polyclonal |
| Gene | DDX11 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DDX11 Antibody [NBP2-38060] - Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18509_DDX11-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38060-img0001.jpg)
Immunocytochemistry/Immunofluorescence: DDX11 Antibody [NBP2-38060] - Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus.
![Immunohistochemistry: DDX11 Antibody [NBP2-38060] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18510_DDX11%2520Antibody-Immunohistochemistry-NBP2-38060-img0002.jpg)
Immunohistochemistry: DDX11 Antibody [NBP2-38060] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells and non-germinal center cells.