alpha 1 Mannosidase 1A Antibody
| Name | alpha 1 Mannosidase 1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37938 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | alpha 1 Mannosidase 1A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MAN1A1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm and the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18531_alpha-1-Mannosidase-1A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37938-img0001.jpg)
Immunocytochemistry/Immunofluorescence: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm and the Golgi apparatus.
![Immunohistochemistry: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18532_alpha%25201%2520Mannosidase%25201A%2520Antibody-Immunohistochemistry-NBP2-37938-img0002.jpg)
Immunohistochemistry: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.