NFIC Antibody
| Name | NFIC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37935 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NFIC Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NFIC |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: NFIC Antibody [NBP2-37935] - Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus and nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18533_NFIC-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37935-img0001.jpg)
![Immunohistochemistry: NFIC Antibody [NBP2-37935] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18534_NFIC%2520Antibody-Immunohistochemistry-NBP2-37935-img0002.jpg)