NF-H Antibody
| Name | NF-H Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37984 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NF-H Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NEFH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: NF-H Antibody [NBP2-37984] - Staining of human cell line HEK 293 shows localization to nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8921_NF-H-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37984-img0003.jpg)
![Immunohistochemistry-Paraffin: NF-H Antibody [NBP2-37984] - Staining of human cerebral cortex shows distinct positivity in neuropil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8922_NF-H-Antibody-Immunohistochemistry-Paraffin-NBP2-37984-img0004.jpg)