RPL27A Antibody
| Name | RPL27A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37979 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: INFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RPL27A Protein |
| Description | Rabbit Polyclonal |
| Gene | RPL27A |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RPL27A Antibody [NBP2-37979] - Immunofluorescent staining of human cell line HEK 293 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18585_RPL27A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37979-img0001.jpg)
Immunocytochemistry/Immunofluorescence: RPL27A Antibody [NBP2-37979] - Immunofluorescent staining of human cell line HEK 293 shows positivity in cytoplasm.
![Immunohistochemistry: RPL27A Antibody [NBP2-37979] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18586_RPL27A%2520Antibody-Immunohistochemistry-NBP2-37979-img0002.jpg)
Immunohistochemistry: RPL27A Antibody [NBP2-37979] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.