villin-like Antibody
| Name | villin-like Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37878 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PKTSISEKARGLALTYSLRDRERGGGRAQIGVVDDEAKAPDLMQIMEAVLGRRVGSLRAATPSKDINQLQKANVRLYHVYEKG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | VILL |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: villin-like Antibody [NBP2-37878] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus, nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18617_villin-like-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37878-img0001.jpg)
Immunocytochemistry/Immunofluorescence: villin-like Antibody [NBP2-37878] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus, nucleoli and cytoplasm.
![Immunohistochemistry: villin-like Antibody [NBP2-37878] - Staining of human nasopharynx shows moderate membranous positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18618_villin-like%2520Antibody-Immunohistochemistry-NBP2-37878-img0002.jpg)
Immunohistochemistry: villin-like Antibody [NBP2-37878] - Staining of human nasopharynx shows moderate membranous positivity in respiratory epithelial cells.