TTC21B Antibody
| Name | TTC21B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37876 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNALDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TTC21B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TTC21B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TTC21B Antibody [NBP2-37876] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7130_TTC21B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37876-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TTC21B Antibody [NBP2-37876] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
![Immunohistochemistry-Paraffin: TTC21B Antibody [NBP2-37876] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7131_TTC21B-Antibody-Immunohistochemistry-Paraffin-NBP2-37876-img0003.jpg)
Immunohistochemistry-Paraffin: TTC21B Antibody [NBP2-37876] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.