Tm9sf3 Antibody
| Name | Tm9sf3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80736 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIWG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Tm9sf3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TM9SF3 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: Tm9sf3 Antibody [NBP1-80736] - staining of human cell line U-2 OS shows positivity in vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18641_Tm9sf3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80736-img0003.jpg)
![Immunohistochemistry-Paraffin: Tm9sf3 Antibody [NBP1-80736] - Staining of human duodenum shows strong granular/ dot like cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18642_Tm9sf3%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80736-img0002.jpg)