Trichohyalin Antibody
| Name | Trichohyalin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80687 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Trichohyalin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TCHH |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Trichohyalin Antibody [NBP1-80687] - Staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & cytoskeleton (intermediate filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18662_Trichohyalin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80687-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Trichohyalin Antibody [NBP1-80687] - Staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & cytoskeleton (intermediate filaments).
![Immunohistochemistry-Paraffin: Trichohyalin Antibody [NBP1-80687] - Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18663_Trichohyalin-Antibody-Immunohistochemistry-Paraffin-NBP1-80687-img0005.jpg)
Immunohistochemistry-Paraffin: Trichohyalin Antibody [NBP1-80687] - Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.